Data

Crystal Structures of Three Classes of Non-Steroidal Anti-Inflammatory Drugs in Complex with Aldo-Keto Reductase 1C3

Monash University
Australian Synchrotron (Associated with)
Viewed: [[ro.stat.viewed]] Cited: [[ro.stat.cited]] Accessed: [[ro.stat.accessed]]
ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Adc&rfr_id=info%3Asid%2FANDS&rft_id=https://store.synchrotron.org.au/experiment/view/251/#metadata&rft.title=Crystal Structures of Three Classes of Non-Steroidal Anti-Inflammatory Drugs in Complex with Aldo-Keto Reductase 1C3&rft.identifier=https://store.synchrotron.org.au/experiment/view/251/#metadata&rft.publisher=Monash University&rft.description=Aldo-keto reductase 1C3 (AKR1C3) catalyses the NADPH dependent reduction of carbonyl groups in a number of important steroid and prostanoid molecules. The enzyme is also over-expressed in prostate and breast cancer and its expression is correlated with the aggressiveness of the disease. The steroid products of AKR1C3 catalysis are important in proliferative signalling of hormone-responsive cells, while the prostanoid products promote prostaglandin-dependent proliferative pathways. In these ways, AKR1C3 contributes to tumour development and maintenance, and suggest that inhibition of AKR1C3 activity is an attractive target for the development of new anti-cancer therapies. Non-steroidal anti-inflammatory drugs (NSAIDs) are one well-known class of compounds that inhibits AKR1C3, yet crystal structures have only been determined for this enzyme with flufenamic acid, indomethacin, and closely related analogues bound. While the flufenamic acid and indomethacin structures have been used to design novel inhibitors, they provide only limited coverage of the NSAIDs that inhibit AKR1C3 and that may be used for the development of new AKR1C3 targeted drugs. To understand how other NSAIDs bind to AKR1C3, we have determined ten crystal structures of AKR1C3 complexes that cover three different classes of NSAID, N-phenylanthranilic acids (meclofenamic acid, mefenamic acid), arylpropionic acids (flurbiprofen, ibuprofen, naproxen), and indomethacin analogues (indomethacin, sulindac, zomepirac). The N-phenylanthranilic and arylpropionic acids bind to common sites including the enzyme catalytic centre and a constitutive active site pocket, with the arylpropionic acids probing the constitutive pocket more effectively. By contrast, indomethacin and the indomethacin analogues sulindac and zomepirac, display three distinctly different binding modes that explain their relative inhibition of the AKR1C family members. This new data from ten crystal structures greatly broadens the base of structures available for future structure-guided drug discovery efforts.This work was funded by Lottery Health Research (CJS; grant number 265027), the Auckland Medical Research Foundation (JUF and CJS; grant number 1110004. JUF; grant number 1109008), the National eScience Infrastructure (JUF), and the Maurice Wilkins Centre for Molecular Biodiscovery Flexible Research Seeding Programme (JUF and CJS). We further acknowledge salary support from the Maurice Wilkins Centre for Molecular Biodiscovery (CJS, JUF) and Summer Studentship funding from the Faculty of Science, University of Auckland (CJS, RMT).   Beamline: MX2 EPN: 3432z PDB: 3R94 Organism: Homo sapiens Expression System: Escherichia coli Sequence: >3R94:A|PDBID|CHAIN|SEQUENCE MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIF YTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLA KSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRD   &rft.creator=Anonymous&rft.date=2014&rft.relation=10.1371/journal.pone.0043965&rft_rights=This experiment data is licensed under Creative Commons Attribution 3.0 Australia (CC BY 3.0). http://creativecommons.org/licenses/by/3.0/au/&rft_subject=OTHER BIOLOGICAL SCIENCES&rft_subject=BIOLOGICAL SCIENCES&rft_subject=Synchrotrons; Accelerators; Instruments and Techniques&rft_subject=PHYSICAL SCIENCES&rft_subject=OTHER PHYSICAL SCIENCES&rft_subject=Escherichia coli &rft_subject=Crystal Structures&rft_subject=MX2&rft.type=dataset&rft.language=English Access the data

Licence & Rights:

view details

This experiment data is licensed under Creative Commons Attribution 3.0 Australia (CC BY 3.0).
http://creativecommons.org/licenses/by/3.0/au/

Access:

Other view details

Brief description

Aldo-keto reductase 1C3 (AKR1C3) catalyses the NADPH dependent reduction of carbonyl groups in a number of important steroid and prostanoid molecules. The enzyme is also over-expressed in prostate and breast cancer and its expression is correlated with the aggressiveness of the disease. The steroid products of AKR1C3 catalysis are important in proliferative signalling of hormone-responsive cells, while the prostanoid products promote prostaglandin-dependent proliferative pathways. In these ways, AKR1C3 contributes to tumour development and maintenance, and suggest that inhibition of AKR1C3 activity is an attractive target for the development of new anti-cancer therapies. Non-steroidal anti-inflammatory drugs (NSAIDs) are one well-known class of compounds that inhibits AKR1C3, yet crystal structures have only been determined for this enzyme with flufenamic acid, indomethacin, and closely related analogues bound. While the flufenamic acid and indomethacin structures have been used to design novel inhibitors, they provide only limited coverage of the NSAIDs that inhibit AKR1C3 and that may be used for the development of new AKR1C3 targeted drugs. To understand how other NSAIDs bind to AKR1C3, we have determined ten crystal structures of AKR1C3 complexes that cover three different classes of NSAID, N-phenylanthranilic acids (meclofenamic acid, mefenamic acid), arylpropionic acids (flurbiprofen, ibuprofen, naproxen), and indomethacin analogues (indomethacin, sulindac, zomepirac). The N-phenylanthranilic and arylpropionic acids bind to common sites including the enzyme catalytic centre and a constitutive active site pocket, with the arylpropionic acids probing the constitutive pocket more effectively. By contrast, indomethacin and the indomethacin analogues sulindac and zomepirac, display three distinctly different binding modes that explain their relative inhibition of the AKR1C family members. This new data from ten crystal structures greatly broadens the base of structures available for future structure-guided drug discovery efforts.

This work was funded by Lottery Health Research (CJS; grant number 265027), the Auckland Medical Research Foundation (JUF and CJS; grant number 1110004. JUF; grant number 1109008), the National eScience Infrastructure (JUF), and the Maurice Wilkins Centre for Molecular Biodiscovery Flexible Research Seeding Programme (JUF and CJS). We further acknowledge salary support from the Maurice Wilkins Centre for Molecular Biodiscovery (CJS, JUF) and Summer Studentship funding from the Faculty of Science, University of Auckland (CJS, RMT).

 

  • Beamline: MX2
  • EPN: 3432z
  • PDB: 3R94
  • Organism: Homo sapiens
  • Expression System: Escherichia coli
  • Sequence: >3R94:A|PDBID|CHAIN|SEQUENCE MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIF YTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLA KSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRD  

Available: 24 03 2014

This dataset is part of a larger collection

ACN 633 798 857