Full description
Following its secretion from cytotoxic lymphocytes into the immune synapse, perforin binds to target cell membranes through its Ca2 + -dependent C2 domain. Membrane-bound perforin then forms pores that allow passage of pro-apoptopic granzymes into the target cell. In the present study, structural and biochemical studiesrevealthatCa2+ bindingtriggersaconformationalchange in the C2 domain that permits four key hydrophobic residues to interact with the plasma membrane. However, in contrast with previous suggestions, these movements and membrane binding do not trigger irreversible conformational changes in the pore-forming MACPF (membrane attack complex/perforin- like) domain, indicating that subsequent monomer–monomer interactions at the membrane surface are required for perforin pore formation.
- Beamline: MX2
- EPN: 4297
- PDB: 3W56
- Organisim: Scophthalmus maximus
- Expression System: Escherichia coli
- Sequence: >3W56:A|PDBID|CHAIN|SEQUENCE MRGSHHHHHHENLYFQGQNSHMQLRLYNLRVRGLPSDLMGITDGYVKVFCGSANLGETSVNHNNANPWWTEEFSHFKAQE NDILRLEVHDEDTFFDDLLGVCQRQIKVGTHEHDCYLKEGGTLHYMYTLSV
Available: 25 03 2014
Data time period: 25 03 2014
User Contributed Tags
Login to tag this record with meaningful keywords to make it easier to discover